Virtual Laboratory Wiki
Advertisement
  1. UP000001
  2. UP000002
  3. UP000003
  4. UP000004
  5. UP000005
  6. UP000006
  7. UP000007
  8. UP000008
  9. UP000009
  10. UP000010
  11. UP000011
  12. UP000012
  13. UP000013
  14. UP000014
  15. UP000015
  16. UP000016
  17. UP000017
  18. UP000018
  19. UP000019
  20. UP000020
  21. UP000021
  22. UP000022
  23. UP000023
  24. UP000024
  25. UP000025
  26. UP000026
  27. UP000027
  28. UP000028
  29. UP000029
  30. UP000030
  31. UP000031
  32. UP000032
  33. UP000033
  34. UP000034
  35. UP000035
  36. UP000036
  37. UP000037
  38. UP000038
  39. UP000039
  40. UP000040
  41. UP000041
  42. UP000042
  43. UP000043
  44. UP000044
  45. UP000045
  46. UP000046

Без форматирования

|NP_206813.1| co-chaperonin GroES
MKFQPLGERVLVERLEEENKTSSGIIIPDNAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIVGSGSCCHTGNHDHKHAKEHEACCHDHKKH
|NP_206833.1| hypothetical protein HP0031
MNILFGISDTQECYNAIKFAVKLAHSLKEVRFTLLHVSMEVFIYSESGMMDYGQTEALEEEKAKALLKQFEDAFKKENIECESVLKSGDLIDVVLDMAKDYDLLLIGASESNLLYRLFISHQNSLVEQSSIPVVIAK
|NP_206872.1| urease beta subunit (urea amidohydrolase) (ureB)
MKKISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEELDLIITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHFISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGFKIHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKSIKEDVQFADSRIRPQTIAAEDTLHDMGIFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDANITFVSQAAYDKGIKEELGLERQVLPVKNCRNITKKDMQFNDTTAHIEVNPETYHVFVDGKEVTSKPANKVSLAQLFSIF
|NP_206883.1| 30S ribosomal protein S9
MRKIYATGKRKTAIAKVWLTPGKGELSINEQSLNQWLGGHEAIKMKVMQPLLLTKQEQSVDIKAVVFGGGYSAQAEALRHGISKALNAYDIAFRAILKPKGLLTRDSRVVERKKYGKRKARRSPQFSKR
|NP_206885.1| hypothetical protein HP0085
MQKEQEAQEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASAQMSHQIKKIEERLNQEQK
|NP_206922.1| hypothetical protein HP0122
MYRRLLLNLFCMVFLQACLKPMSDPKAEKVDSQVQCGFGSKDC
|NP_206925.1| 50S ribosomal protein L35
MPKMKTNRGASKRFKVKKNLIKRGSAFKSHILTKKSPKRKANLNAPKHVHHTNAHSVMSLLCRA
|NP_206935.1| hypothetical protein HP0135
MRISLLAVILALLFVACHETKKQILQNEADSTPSEKTIWQPEQK
|NP_207043.1| hypothetical protein HP0245
MINNNKAMLEQYNVSKLASEEKLKALAQNKNDKLLKEQTDSFEALLLKFMLDSAMKMDNPLYPKAPGDEIYASMYKDTLSKELSGNFGYSEMLFNFLKEQEKQKP
|NP_207163.1| hypothetical protein HP0365
MAKLVDALDLGSSAARHEGSIPFFRTILND
|NP_207184.1| hypothetical protein HP0386
MSLENDSLEITYLGKRYKISLNNTFSDEMKRTLKERFHNQELNALELLKDYLHESCQNEYLHNELQKLLEKISSCSIT
|NP_207198.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
MEIKMAKDYGFCFGVKRAIQIAEKNQNSLIFGSLIHNAKEINRLEKNFNVKIEEDPKKIPKNKSVIIRTHGIPKQDLEYLKNKGVKITDATCPYVIKPQQIVESMSKEGYQIVLFGDINHPEVKGVISYATNQALVVNSLEELQEKKLQRKVALVSQTTKQTPKLLQIASYLVERCTEVRIFNTICNATSYNQKAALDLSKEVDIMIVVGGKTSSNTKQLLSIAKQHCKDSYLVEDENELELAWFKDKKLCGITAGASTPDWIIENVKQKISTI
|NP_207202.1| protein kinase C inhibitor (SP:P16436)
MNVFEKIIQGEIPCSKILENERFLSFYDINPKAKVHALVIPKQSIQDFNGITPELMAQMTSFIFEVVEKLGIKEKGYKLLTNVGKNAGQEVMHLHFHILSGDKH
|NP_207265.1| hypothetical protein HP0467
MRIIIRLLSFKMNAFLKLALASLMGGLWYAFNGEGSEIVAIGIFVLILFVFFIRPVSFQDPEKREEYIERLKKNHERKMILQDKQKEEQMRLYQAKKERESRQKQDLKEQMKKYS
|NP_207288.1| 50S ribosomal protein L28
MAKRCALTFKGPMIGNHVSHANNKNKRRLLPNLRSIKIQLDDGTTKRIKVAASTLRTMRKGA
|NP_207346.1| 50S ribosomal protein L31
MKKGIHPEYIPCKVTCVTSGKEIEVLSTKPEMRIDISSFCHPFYTGSDKIADTAGRVEKFKQRYNLK
|NP_207355.1| hypothetical protein HP0560
MGIIYLILFLIVIYLLYRILDVLEQK
|NP_207396.1| flagellin
MAFQVNTNINAMNAHVQSALTQNALKTSLERLSSGLRINKAADDASGMTVADSLRSQASSLGQAIANTNDGMGIIQVADKAMDEQLKILDTVKVKATQAAQDGQTTESRKAIQSDIVRLIQGLDNIGNTTTYNGQALLSGQFTNKEFQVGAYSNQSIKASIGSTTSDKIGQVRIATGALITASGDISLTFKQVDGVNDVTLESVKVSSSAGTGIGVLAEVINKNSNRTGVKAYASVITTSDVAVQSGSLSNLTLNGIHLGNIADIKKNDSDGRLVAAINAVTSETGVEAYTDQKGRLNLRSIDGRGIEIKTDSVSNGPSALTMVNGGQDLTKGSTNYGRLSLTRLDAKSINVVSASDSQHLGFTAIGFGESQVAETTVNLRDVTGNFNANVKSASGANYNAVIASGNQSLGSGVTTLRGAMVVIDIAESAMKMLDKVRSDLGSVQNQMISTVNNISITQVNVKAAESQIRDVDFAEESANFNKNNILAQSGSYAMSQANTVQQNILRLLT
|NP_207458.1| hypothetical protein HP0664
MEKLPKKRVSKTKSQKLIHSLTTQKNRAFLKKISANEMLLELEKGAFKKNEAYFISDEEDKNYVLVPDNVISLLAENARKAFEARLRAELERDIITQAPIDFEDVREVSLQLLENLRQKDGNLPNINTLNFVKQIKKEHPNLFFNFDNMFKQPPFNENNFENFDNSDEENF
|NP_207608.1| flagellar motor protein
MDLSTILGLVLAVASISLGDILEDGNPLHIIHLSSVIIIVPTSLFAAMTGTHARYVKAAYKEIKIVFLNPKINLNETIKNLVELATLARKDGVLSLEGRVAQIEDDFTRNGLSMIIDGKDLKSVKESLEISIEEMEEYYHGAAHYWETAGETAPTMGLVGAVMGLMLALQKLDNPAEMAAGIAGAFTATVTGIMCSYAIFGPFGHKLKAKSKDIIKEKTVLLEGILGIANGENPRDLENKLLNYIAPGEPKKSQFEG
|NP_207617.1| thioredoxin (trxA)
MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTKDGEVVHQLVGVQTKVALKEQLNKLLG
|NP_207660.1| transcription elongation factor GreA
MNKEPMSMHGYNKICAELKQLKEVERPNIVKEIDIARGHGDLKENAEYHAAKEKQRFIEARIVDLSEIVANAQVIDPSALAHNKVSFGSTIKILNLDNDKEFSYTIVGSVESDPAKGLISFGSPIAKSLIGKSKGDAVSIQLPNGESDFEILDIYYKEICFDEN
|NP_207663.1| hydrogenase nickel incorporation protein
MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKDAILDIVDEKVELECKDCSHVFKPNALDYGVCEKCHSKNVIITQGNEMRLLSLEMLAE
|NP_207684.1| hypothetical protein HP0891
MPQIQSSHSNHFDFTIDTADRTKLLMSYLVVPTTANFNNVMHGGELLNLLDKVAYVCSTRYCAKGTVTLSVDGVTFKYPIPVGNLLTFLASINYVGNTSCEVGIKVLSEDIKTREITHTNSCYFTMVAVENGKPTPMPKYEPKTEVEIRRYEGALKRKEMRTRGYLKSGKHEGV
|NP_207857.1| hypothetical protein HP1066
MHYLRILILSMSFLNILNAENLSYMSSSYQIGTVFMRPLNTNKLLQGASILQGYEVNPKNDWAYSRYYFFIDYGNVLFNNDSTLQANMFTYGVGGDFMVAYAKNPINRWAFFFGLQLAANTWILNNKVKDLVVNTWDSLKDFNFHNTYFRAIGKFGVQFRTIVLYHKVDVEIGMKIFLTPERRSLFERSFLFFVSHSWHF
|NP_207900.1| pyruvate ferredoxin oxidoreductase, delta subunit
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICINCFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQWPQKQEKKKS
|NP_207954.1| hypothetical protein HP1163
MNTEILTIMLVVSVLMGLVGLIAFLWGVKSGQFDDEKRMLESVLYDSASDLNEAILQEKRQKN
|NP_207987.1| 30S ribosomal protein S7
MRRRKAPVREVLGDPVYGNKVVTKFINKMMFDGKKSVAEKIIYKAFNKIEEKSGEKGIEVFEKALERVRPLVEVRSRRVGGATYQVPVEVRASRQQSLSIRWILEATRKRNERMMVDRLANELMDAASDKGAAFKKKEDVHKMAEANKAFAHYRW
|NP_207988.1| 30S ribosomal protein S12
MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKATDKKATDNKKK
|NP_207993.1| 50S ribosomal protein L11
MAKKVVGEIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVIITVYQDKSFTFITKKPPVTDLIKKASGVEKGSDNPLKNKIAKLTHKQVEEIAQLKMEDLNTSTMEAAKKIVMGSARSMGVEVVD
|NP_207996.1| 50S ribosomal protein L33
MKVKIGLKCSDCEDINYSTTKNAKTNTEKLELKKFCPRENKHTLHKEIKLKS
|NP_208007.1| hypothetical protein HP1215
MSADVGYDIRNNVVLNWNVGIYKKIRCFGIGFQFVNQRRPILTGDPNQPIRVFENNYVKLELDFSPITKTNVTYRSLQRK
|NP_208036.1| 30S ribosomal protein S18
MERKRYSKRYCKYTEAKISFIDYKDLDMLKHTLSERYKIMPRRLTGNSKKWQERVEVAIKRARHMALIPYIVDRKKVVDSPFKQH
|NP_208090.1| translation initiation factor IF-1
MARDDVIEVDGKVIEALPNATFKVELDNKHVVLCRISGKMRMHYIRIALGDRVKLELTPYSLDKGRITFRYK
|NP_208094.1| 30S ribosomal protein S5
MTERKGMEEINREEFQEVVVNIGRVTKVVKGGRRFRFNALVVVGNKNGLVGFGLGKAKEVPDAIKKAVDDAFKNLIHVTIKGTTIAHDIEHKYNASRILLKPASEGTGVIAGGSTRPIVELAGIKDILTKSLGSNNPYNVVRATFDALAKIKA
|NP_208097.1| 30S ribosomal protein S8
MVNDIIADSLTRLRNASMRRLEFTQLYYAKIVVSILEIFKEKGFIKDFNVKDKDKKQSVYVQLAYDEKGHSKISEVKRLSKPGRRVYKQKNELKRFKNGYGVIVVSTSKGVITNEEAYRQNVGGEVLCSIW
|NP_208102.1| 30S ribosomal protein S17
MNTKEPHKRLVQGKVISKFAEKSAVILVERKVVHEKYRKIVKKFKKYTIHDENNQVKVGDFVSAIECRPLSKTKSFTLKEILVVGV
|NP_208109.1| 50S ribosomal protein L23
MADIMDIKSILYTEKSLGLQEKGVLVVQTAQNVTKNQLKEVFKTYFGFEPLKINSLKQEGKVKRFRGKLGQRKSFKKFYVKVPEGASIAALGA
|NP_208112.1| 30S ribosomal protein S10
MEKIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSREQFEIRVYSRLIDIISATPETVDSLMKLDLAPEVDVEVTSMETK
|NP_208210.1| flagellar biosynthesis protein
MESQLMKLAIETYKITLMISLPVLLAGLVVGLLVSIFQATTQINEMTLSFVPKILAVIGVLILTMPWMTNMLLDYTKTLIKLIPKIIG
|NP_208218.1| histidine-rich, metal binding polypeptide (hpn)
MAHHEEQHGGHHHHHHHTHHHHYHGGEHHHHHHSSHHEEGCCSTSDSHHQEEGCCHGHHE
|NP_208237.1| biopolymer transport protein (exbD)
MKKVESMNVVPFIDIMLVLLVIVLTTASFVQTSKLPISIPQVDKDSTDSKDVLDKKQVTIAISNKGSFYFDDKEISFENLKHKVSTLAKDTPIVLQGDKKSNLDNFIKVVDLLQTNNLKQLYILVEDKKNQKN
|NP_208238.1| 50S ribosomal protein L34
MKRTYQPHNTPRKRTHGFLVRMKTKNGRKVINARRAKGRKKLSV
|NP_208247.1| membrane-associated lipoprotein (lpp20)
MKNQVKKILGMSVVAAMVIVGCSHAPKSGISKSNKAYKEATKGAPDWVVGDLEKVAKYEKYSGVFLGRAEDLITNNDVDYSTNQATAKARANLAANLKSTLQKDLENEKTRTVDASGKRSISGTDTEKISQLVDKELIASKMLARYVGKDRVFVLVGLDKQIVDKVREELGMVKK
|NP_208283.1| conserved hypothetical nifU-like protein
MIEFSDEDLQKPVRIVIEKIRPYLLKDGGNIEVLGVKSMKIYVALEGACKTCSSSKITLKNVIERQLKMDIHPNLEVVCLENAKEFDKL
|NP_208321.1| hypothetical protein HP1531
MFEKIRKILADIEDSQNEIEMLLKLANLSLGDFIEIKRGSMDMPKGVNEAFFTQLSEEVERLKELINALNKIKKGLLVF
|NP_208348.1| flagellar basal body protein
MQAIHNDKSLLSPFSELNTDNRTKREESGSTFKEQKGGEFSKLLKQSINELNNTQEQSDKALADMATGQIKDLHQAAIAIGKAETSMKLMLEVRNKAISAYKELLRTQI

Advertisement